PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc01g009860.2.1
Common NameLOC100147720, unknown
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 273aa    MW: 31335.3 Da    PI: 9.9811
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc01g009860.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.61.2e-49141411128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrF+Ptdeelvv+yLk+kv + +l++ ++i+ev++yk++PwdLp      e+e yfFs+++ ky++g+r+nrat+sgyWkatg dk+
  Solyc01g009860.2.1  14 LPPGFRFRPTDEELVVQYLKRKVFSFPLPA-SIIPEVEVYKSDPWDLPGD---MEQEKYFFSTKEVKYPNGNRSNRATNSGYWKATGIDKQ 100
                         79****************************.89***************54...46799********************************* PP

                 NAM  92 vlsk....kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++ +    +++l+glkktLvfy+g++p+g +t+W+mheyrl
  Solyc01g009860.2.1 101 IILRgrqqQQQLIGLKKTLVFYRGKSPHGCRTNWIMHEYRL 141
                         **9976655666***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-5710163IPR003441NAC domain
PROSITE profilePS5100556.48814163IPR003441NAC domain
PfamPF023653.7E-2615141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0010089Biological Processxylem development
GO:0010150Biological Processleaf senescence
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MEKVNFLKNG VLRLPPGFRF RPTDEELVVQ YLKRKVFSFP LPASIIPEVE VYKSDPWDLP  60
GDMEQEKYFF STKEVKYPNG NRSNRATNSG YWKATGIDKQ IILRGRQQQQ QLIGLKKTLV  120
FYRGKSPHGC RTNWIMHEYR LANLESNYHP IQGNWVICRI FLKKRGNTKN KEENMTTHDE  180
VRNREIDKNS PVVSVKMSSR DSEALASANS ELKKKASIIF YDFMGRNNSN GVAASTSSSG  240
ITDLTTTNEE SDDHEESTSS FNNFTTFKRK IN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B6e-501216915171NAC domain-containing protein 19
4dul_A6e-501216915171NAC domain-containing protein 19
1ut7_B6e-501216915171NO APICAL MERISTEM PROTEIN
1ut7_A6e-501216915171NO APICAL MERISTEM PROTEIN
1ut4_B6e-501216915171NO APICAL MERISTEM PROTEIN
1ut4_A6e-501216915171NO APICAL MERISTEM PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.138950.0callus| flower| fruit| leaf| seed
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00507DAPTransfer from AT5G13180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankZ755240.0L.esculentum partial mRNA (clone SENU5)
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001233811.10.0uncharacterized protein LOC100147720
SwissprotQ9FY938e-86NAC83_ARATH; NAC domain-containing protein 83
TrEMBLQ435210.0Q43521_SOLLC; Uncharacterized protein
STRINGSolyc01g009860.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13872377
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.12e-77NAC domain containing protein 83
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. John I, et al.
    Cloning and characterization of tomato leaf senescence-related cDNAs.
    Plant Mol. Biol., 1997. 33(4): p. 641-51
    [PMID:9132056]